A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10621
Swiss-prot Accession number	P37036 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	96 Amino acids
Molecular weight	10721
References	1   Karasev V.S., Pankov Y.A.; "Amino acid sequence of reduced and carboxymethylated alpha- and beta-subunits of the little picked whale luteinizing hormone."; Biokhimiia 50:1972-1986(1985).
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPBGZFTMZGCPZCKLKZBKYFSKLGAPIYZCMGCCFSRAYPTPARSKKTMLVPKNITSZATCCVAKAFTKATVMGBARVZNHTZCHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (1-96)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10633
Swiss-prot Accession number	P33088 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	118 Amino acids
Molecular weight	12415
References	1   Karasev V.S., Pankov Y.A.; "Amino acid sequence of reduced and carboxymethylated alpha- and beta-subunits of the little picked whale luteinizing hormone."; Biokhimiia 50:1972-1986(1985).
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	PRGPLRPLCRPINATLAAZBZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRZLRFASIRLPGCPPGVBPMVSFPVALSCHCGPCRLSSSBCGPGRAZPLACBRSPRPGL
Position of mature hormone in Pre-Hormone protein	118 Residues from position (1-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11214
Swiss-prot Accession number	P11184 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6098
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSTNDLIKACGRELVRLWVEICGSVRWGQSAL
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11215
Swiss-prot Accession number	P11184 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6098
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	RMTLSEKCCQVGCIRKDIARLC
Position of mature hormone in Pre-Hormone protein	22 Residues from position (33-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated